PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G065700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 336aa    MW: 37802.3 Da    PI: 5.3962
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G065700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.4e-181461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEde+lvd++++ G ++W+  ++  g++R++k+c++rw +yl
  Manes.17G065700.1.p 14 KGPWTPEEDEKLVDYINRNGHESWTNLPKLAGLNRCGKSCRLRWINYL 61
                         79********************************************97 PP

2Myb_DNA-binding55.11.7e-1767111147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          rg++++eE+ l+v+++  lG++ W++Ia +++ gRt++++k++w+++
  Manes.17G065700.1.p  67 RGKFSQEEERLIVNLHSVLGNK-WSRIATHLP-GRTDNEIKNFWNTH 111
                          89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-24664IPR009057Homeodomain-like
PROSITE profilePS5129417.56961IPR017930Myb domain
SuperFamilySSF466893.55E-3011108IPR009057Homeodomain-like
SMARTSM007176.0E-141363IPR001005SANT/Myb domain
PfamPF002493.4E-161461IPR001005SANT/Myb domain
CDDcd001675.02E-101661No hitNo description
PROSITE profilePS5129427.65462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2665116IPR009057Homeodomain-like
SMARTSM007173.0E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1567111IPR001005SANT/Myb domain
CDDcd001672.30E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MVRSPFCYSS SLKKGPWTPE EDEKLVDYIN RNGHESWTNL PKLAGLNRCG KSCRLRWINY  60
LRPDIKRGKF SQEEERLIVN LHSVLGNKWS RIATHLPGRT DNEIKNFWNT HIRKKLLQMG  120
IDPNTHRPRT DFNHLSNLSF LLFGNLTSPW NNVFKLQHSD VAHLINIRLL HNLLQITNTR  180
SFPSITVSGG TQNLNPLEQL LNKTATTSLY IEEPFPRTED LPLQAPTEVT DAANIWAALE  240
GEMLLDLDME NNKLMNSCCD TQIGNSLLDQ LISASSSSSP ESSMVNQMES NGNPLDDNEG  300
SGSGSGSGSP TFSVFDSWEK LIDDESGSFW NDIQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028156.11e-122PREDICTED: transcription factor MYB39-like isoform X2
TrEMBLB9MU451e-121B9MU45_POPTR; Uncharacterized protein
STRINGPOPTR_0001s02240.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.13e-73myb domain protein 93